Lineage for d6e0sa_ (6e0s A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2602905Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2602906Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2603526Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2603527Protein automated matches [190418] (31 species)
    not a true protein
  7. 2603939Species Soil metagenome [TaxId:410658] [355207] (1 PDB entry)
  8. 2603940Domain d6e0sa_: 6e0s A: [355208]
    automated match to d3vpea_
    complexed with gol, po4, zn

Details for d6e0sa_

PDB Entry: 6e0s (more details), 1.78 Å

PDB Description: crystal structure of mem-a1, a subclass b3 metallo-beta-lactamase isolated from a soil metagenome library
PDB Compounds: (A:) mem-a1

SCOPe Domain Sequences for d6e0sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6e0sa_ d.157.1.0 (A:) automated matches {Soil metagenome [TaxId: 410658]}
dwndpqepfavfgstyyvgvrglsavliaspqghilidggspesapqiaqhirqlgfkle
dvklilnshehfdhaggiselqrlsgatvlasvqgekvlrsgqpskgdpqygelppmtpv
antravadgevvklgplavtarytpghtqggvswtwratengksaamvyadslnafaakp
frysgspaypnaladikksiatvaaldcdilisahpdagdlwrrqarqaelgsaafidrq
acrqyaeragvrlqkklaaeaaek

SCOPe Domain Coordinates for d6e0sa_:

Click to download the PDB-style file with coordinates for d6e0sa_.
(The format of our PDB-style files is described here.)

Timeline for d6e0sa_: