SCOPe 2.07: Domain d5mxpa_: 5mxp A:

Lineage for d5mxpa_ (5mxp A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (124 species)
   not a true protein

7. Species Marinobacter sp. [TaxId:270374] [355180] (1 PDB entry)

8. Domain d5mxpa_: 5mxp A: [355181]
   automated match to d4f60a_
   complexed with act, na

Details for d5mxpa_

PDB Entry: 5mxp, 1.45 Å

PDB Description: haloalkane dehalogenase dmxa from marinobacter sp. elb17 possessing a unique catalytic residue

PDB Compounds: (A:) Alpha/beta hydrolase

SCOPe Domain Sequences for d5mxpa_:

Sequence; same for both SEQRES and ATOM records:

>d5mxpa_ c.69.1.0 (A:) automated matches {Marinobacter sp. [TaxId: 270374]}
tqkpadfpypshfadvlgsrmhyvehgngdpllflhgqptwsylwrkvlpelegkgrlia
vdligygmsdkpdipydiddhiryldgfiealgldritivchdwgsffgfhyahrhperi
kglafmeamlnpipgydafdpqtraffqtlrssqanaermmmdenqfvenilpamicrpl
erqeldayrapwtdrqsrrilctfpqnlcigkepasvyrmqtayiewlgqtdlpklliha
epgflipapavdqyrqqlpnletafvgsglhyiqedqpqkigqaiaqwmdrcgl

Timeline for d5mxpa_:

• d5mxpa_ is new in SCOPe 2.07-stable
  
• d5mxpa_ appears in the current release, SCOPe 2.08