SCOPe 2.08: Domain d6f3zb1: 6f3z B:1-182

Lineage for d6f3zb1 (6f3z B:1-182)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.125: LolA-like prokaryotic lipoproteins and lipoprotein localization factors [89391] (1 superfamily)
   11 stranded sheet partly folded in a corner-like structure filled with a few short helices

4. Superfamily b.125.1: Prokaryotic lipoproteins and lipoprotein localization factors [89392] (4 families)

5. Family b.125.1.1: Outer-membrane lipoproteins carrier protein LolA [89393] (2 proteins)
   automatically mapped to Pfam PF03548

6. Protein automated matches [190946] (3 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [355139] (2 PDB entries)

8. Domain d6f3zb1: 6f3z B:1-182 [355179]
   Other proteins in same PDB: d6f3zb2, d6f3zd2
   automated match to d3ksna_

Details for d6f3zb1

PDB Entry: 6f3z, 2 Å

PDB Description: complex of e. coli lola and periplasmic domain of lolc

PDB Compounds: (B:) Outer-membrane lipoprotein carrier protein

SCOPe Domain Sequences for d6f3zb1:

Sequence; same for both SEQRES and ATOM records:

>d6f3zb1 b.125.1.1 (B:1-182) automated matches {Escherichia coli [TaxId: 83333]}
daasdlksrldkvssfhasftqkvtdgsgaavqegqgdlwvkrpnlfnwhmtqpdesilv
sdgktlwfynpfveqatatwlkdatgntpfmliarnqssdwqqynikqngddfvltpkas
ngnlkqftinvgrdgtihqfsaveqddqrssyqlksqqngavdaakftftppqgvtvddq
rk

Timeline for d6f3zb1:

• d6f3zb1 first appeared in SCOPe 2.07