Lineage for d6goka_ (6gok A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. Protein Ribonuclease A (also ribonuclease B, S) [54078] (4 species)
  7. Species Cow (Bos taurus) [TaxId:9913] [54079] (210 PDB entries)
  8. Domain d6goka_: 6gok A: [355172]
    automated match to d1kf3a_
    complexed with f6q, pd

Details for d6goka_

PDB Entry: 6gok (more details), 2.65 Å

PDB Description: x-ray structure of the adduct formed upon reaction of bovine pancreatic ribonuclease with a pd(ii) complex bearing n,n- pyridylbenzimidazole derivative with an alkylated sulphonate side chain
PDB Compounds: (A:) ribonuclease pancreatic

SCOPe Domain Sequences for d6goka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6goka_ d.5.1.1 (A:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

SCOPe Domain Coordinates for d6goka_ are not available.

Timeline for d6goka_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6gokb_