SCOPe 2.08: Domain d6gg9a1: 6gg9 A:1-132

Lineage for d6gg9a1 (6gg9 A:1-132)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.0: automated matches [191387] (1 protein)
   not a true family

6. Protein automated matches [190492] (24 species)
   not a true protein

7. Species Pseudomonas putida [TaxId:160488] [256090] (4 PDB entries)

8. Domain d6gg9a1: 6gg9 A:1-132 [355169]
   Other proteins in same PDB: d6gg9a2
   automated match to d5j3wa_
   complexed with fmn; mutant

Details for d6gg9a1

PDB Entry: 6gg9, 2.04 Å

PDB Description: crystal structures of a short blue light photoreceptor protein ppsb1- lov mutant (dark state) - r61h/r66i

PDB Compounds: (A:) Sensory box protein

SCOPe Domain Sequences for d6gg9a1:

Sequence; same for both SEQRES and ATOM records:

>d6gg9a1 d.110.3.0 (A:1-132) automated matches {Pseudomonas putida [TaxId: 160488]}
minaqllqsmvdasndgivvaekegddtiliyvnaafeyltgysrdeilyqdcrflqgdd
hdqlgiarirkamaegrpcrevlrnyrkdgsafwnelsitpvksdfdqrtyfigiqkdvs
rqvelerelael

Timeline for d6gg9a1:

• d6gg9a1 first appeared in SCOPe 2.07