Lineage for d6fnnd1 (6fnn D:1-78)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. Protein automated matches [190233] (31 species)
    not a true protein
  7. Species Candidatus caldiarchaeum [TaxId:311458] [274223] (5 PDB entries)
  8. Domain d6fnnd1: 6fnn D:1-78 [355152]
    Other proteins in same PDB: d6fnnc2, d6fnnd2
    automated match to d2mqja_
    complexed with so4, zn

Details for d6fnnd1

PDB Entry: 6fnn (more details), 1.85 Å

PDB Description: caldiarchaeum subterraneum ubiquitin:rpn11-homolog complex
PDB Compounds: (D:) Ubiquitin-like protein

SCOPe Domain Sequences for d6fnnd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fnnd1 d.15.1.0 (D:1-78) automated matches {Candidatus caldiarchaeum [TaxId: 311458]}
mkikivpavgggsplelevapnatvgavrtkvcamkklppdttrltykgralkdtetles
lgvadgdkfvlitrtvgg

SCOPe Domain Coordinates for d6fnnd1 are not available.

Timeline for d6fnnd1:

Domains from same chain:
(mouse over for more information)
d6fnnd2
Domains from other chains:
(mouse over for more information)
d6fnnc1, d6fnnc2