Class b: All beta proteins [48724] (178 folds) |
Fold b.125: LolA-like prokaryotic lipoproteins and lipoprotein localization factors [89391] (1 superfamily) 11 stranded sheet partly folded in a corner-like structure filled with a few short helices |
Superfamily b.125.1: Prokaryotic lipoproteins and lipoprotein localization factors [89392] (4 families) |
Family b.125.1.1: Outer-membrane lipoproteins carrier protein LolA [89393] (2 proteins) automatically mapped to Pfam PF03548 |
Protein automated matches [190946] (3 species) not a true protein |
Species Escherichia coli [TaxId:83333] [355139] (2 PDB entries) |
Domain d6f3zd1: 6f3z D:1-182 [355150] Other proteins in same PDB: d6f3zb2, d6f3zd2 automated match to d3ksna_ |
PDB Entry: 6f3z (more details), 2 Å
SCOPe Domain Sequences for d6f3zd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6f3zd1 b.125.1.1 (D:1-182) automated matches {Escherichia coli [TaxId: 83333]} daasdlksrldkvssfhasftqkvtdgsgaavqegqgdlwvkrpnlfnwhmtqpdesilv sdgktlwfynpfveqatatwlkdatgntpfmliarnqssdwqqynikqngddfvltpkas ngnlkqftinvgrdgtihqfsaveqddqrssyqlksqqngavdaakftftppqgvtvddq rk
Timeline for d6f3zd1: