SCOPe 2.08: Domain d6dhme1: 6dhm E:1-208

Lineage for d6dhme1 (6dhm E:1-208)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families)

5. Family c.58.1.0: automated matches [227157] (1 protein)
   not a true family

6. Protein automated matches [226864] (40 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [355109] (1 PDB entry)

8. Domain d6dhme1: 6dhm E:1-208 [355148]
   Other proteins in same PDB: d6dhma2, d6dhmb2, d6dhmc2, d6dhmd2, d6dhme2, d6dhmf2
   automated match to d3etda1
   complexed with glu, gtp, ndp, zn

Details for d6dhme1

PDB Entry: 6dhm, 3 Å

PDB Description: bovine glutamate dehydrogenase complexed with zinc

PDB Compounds: (E:) Glutamate dehydrogenase 1, mitochondrial

SCOPe Domain Sequences for d6dhme1:

Sequence; same for both SEQRES and ATOM records:

>d6dhme1 c.58.1.0 (E:1-208) automated matches {Cow (Bos taurus) [TaxId: 9913]}
adreddpnffkmvegffdrgasivedklvedlktreteeqkrnrvrgilriikpcnhvls
lsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdv
pfggakagvkinpknytdnelekitrrftmelakkgfigpgvdvpapdmstgeremswia
dtyastighydinahacvtgkpisqggi

Timeline for d6dhme1:

• d6dhme1 first appeared in SCOPe 2.07