SCOPe 2.07: Domain d6fhmb1: 6fhm B:1-182

Lineage for d6fhmb1 (6fhm B:1-182)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.125: LolA-like prokaryotic lipoproteins and lipoprotein localization factors [89391] (1 superfamily)
   11 stranded sheet partly folded in a corner-like structure filled with a few short helices

4. Superfamily b.125.1: Prokaryotic lipoproteins and lipoprotein localization factors [89392] (4 families)

5. Family b.125.1.1: Outer-membrane lipoproteins carrier protein LolA [89393] (2 proteins)
   automatically mapped to Pfam PF03548

6. Protein automated matches [190946] (3 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [355139] (2 PDB entries)

8. Domain d6fhmb1: 6fhm B:1-182 [355144]
   Other proteins in same PDB: d6fhma2, d6fhmb2
   automated match to d3ksna_
   complexed with gol; mutant

Details for d6fhmb1

PDB Entry: 6fhm, 2.39 Å

PDB Description: crystal structure of the f47e mutant of the lipoprotein localization factor, lola

PDB Compounds: (B:) Outer-membrane lipoprotein carrier protein

SCOPe Domain Sequences for d6fhmb1:

Sequence; same for both SEQRES and ATOM records:

>d6fhmb1 b.125.1.1 (B:1-182) automated matches {Escherichia coli [TaxId: 83333]}
daasdlksrldkvssfhasftqkvtdgsgaavqegqgdlwvkrpnlenwhmtqpdesilv
sdgktlwfynpfveqatatwlkdatgntpfmliarnqssdwqqynikqngddfvltpkas
ngnlkqftinvgrdgtihqfsaveqddqrssyqlksqqngavdaakftftppqgvtvddq
rk

Timeline for d6fhmb1:

• d6fhmb1 is new in SCOPe 2.07-stable
  
• d6fhmb1 appears in the current release, SCOPe 2.08