![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.125: LolA-like prokaryotic lipoproteins and lipoprotein localization factors [89391] (1 superfamily) 11 stranded sheet partly folded in a corner-like structure filled with a few short helices |
![]() | Superfamily b.125.1: Prokaryotic lipoproteins and lipoprotein localization factors [89392] (4 families) ![]() |
![]() | Family b.125.1.1: Outer-membrane lipoproteins carrier protein LolA [89393] (2 proteins) automatically mapped to Pfam PF03548 |
![]() | Protein automated matches [190946] (3 species) not a true protein |
![]() | Species Escherichia coli [TaxId:83333] [355139] (2 PDB entries) |
![]() | Domain d6fhmb1: 6fhm B:1-182 [355144] Other proteins in same PDB: d6fhma2, d6fhmb2 automated match to d3ksna_ complexed with gol; mutant |
PDB Entry: 6fhm (more details), 2.39 Å
SCOPe Domain Sequences for d6fhmb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fhmb1 b.125.1.1 (B:1-182) automated matches {Escherichia coli [TaxId: 83333]} daasdlksrldkvssfhasftqkvtdgsgaavqegqgdlwvkrpnlenwhmtqpdesilv sdgktlwfynpfveqatatwlkdatgntpfmliarnqssdwqqynikqngddfvltpkas ngnlkqftinvgrdgtihqfsaveqddqrssyqlksqqngavdaakftftppqgvtvddq rk
Timeline for d6fhmb1: