Lineage for d6fhma1 (6fhm A:1-182)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2411926Fold b.125: LolA-like prokaryotic lipoproteins and lipoprotein localization factors [89391] (1 superfamily)
    11 stranded sheet partly folded in a corner-like structure filled with a few short helices
  4. 2411927Superfamily b.125.1: Prokaryotic lipoproteins and lipoprotein localization factors [89392] (4 families) (S)
  5. 2411928Family b.125.1.1: Outer-membrane lipoproteins carrier protein LolA [89393] (2 proteins)
    automatically mapped to Pfam PF03548
  6. 2411934Protein automated matches [190946] (3 species)
    not a true protein
  7. 3055077Species Escherichia coli [TaxId:83333] [355139] (2 PDB entries)
  8. 3055078Domain d6fhma1: 6fhm A:1-182 [355140]
    Other proteins in same PDB: d6fhma2, d6fhmb2
    automated match to d3ksna_
    complexed with gol; mutant

Details for d6fhma1

PDB Entry: 6fhm (more details), 2.39 Å

PDB Description: crystal structure of the f47e mutant of the lipoprotein localization factor, lola
PDB Compounds: (A:) Outer-membrane lipoprotein carrier protein

SCOPe Domain Sequences for d6fhma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fhma1 b.125.1.1 (A:1-182) automated matches {Escherichia coli [TaxId: 83333]}
daasdlksrldkvssfhasftqkvtdgsgaavqegqgdlwvkrpnlenwhmtqpdesilv
sdgktlwfynpfveqatatwlkdatgntpfmliarnqssdwqqynikqngddfvltpkas
ngnlkqftinvgrdgtihqfsaveqddqrssyqlksqqngavdaakftftppqgvtvddq
rk

SCOPe Domain Coordinates for d6fhma1:

Click to download the PDB-style file with coordinates for d6fhma1.
(The format of our PDB-style files is described here.)

Timeline for d6fhma1:

  • d6fhma1 appears in periodic updates to SCOPe 2.07 starting on 2018-07-26

View in 3D
Domains from same chain:
(mouse over for more information)
d6fhma2