SCOPe 2.07: Domain d6dxpa1: 6dxp A:1-201

Lineage for d6dxpa1 (6dxp A:1-201)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.0: automated matches [191330] (1 protein)
   not a true family

6. Protein automated matches [190158] (30 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [355132] (1 PDB entry)

8. Domain d6dxpa1: 6dxp A:1-201 [355137]
   Other proteins in same PDB: d6dxpa2, d6dxpb2, d6dxpd2
   automated match to d2z98a_
   complexed with fmn

Details for d6dxpa1

PDB Entry: 6dxp, 2.48 Å

PDB Description: the crystal structure of an fmn-dependent nadh-azoreductase from klebsiella pneumoniae

PDB Compounds: (A:) FMN-dependent NADH-azoreductase

SCOPe Domain Sequences for d6dxpa1:

Sequence; same for both SEQRES and ATOM records:

>d6dxpa1 c.23.5.0 (A:1-201) automated matches {Klebsiella pneumoniae [TaxId: 573]}
manvlvlkssingetsltnqlineflaarqaaghgdrliehdlsamalptldrplfaalr
gavdpqpaireavalsdqliaelkasdllvigapmynlnvptdlkkwfdlvararetfry
teswpqglvegvravvvssrggihqgettdavtpylravlglmgiqevefiyaegldnrp
hgrdagiasaraqiarlavpa

Timeline for d6dxpa1:

• d6dxpa1 is new in SCOPe 2.07-stable
  
• d6dxpa1 appears in the current release, SCOPe 2.08