Lineage for d6dhzc_ (6dhz C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311272Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2311322Superfamily a.24.3: Cytochromes [47175] (3 families) (S)
    Heme-containing proteins
  5. 2311323Family a.24.3.1: Cytochrome b562 [47176] (2 proteins)
    automatically mapped to Pfam PF07361
  6. 2311324Protein Cytochrome b562 [47177] (1 species)
  7. 2311325Species Escherichia coli [TaxId:562] [47178] (44 PDB entries)
  8. 3055057Domain d6dhzc_: 6dhz C: [355119]
    automated match to d3m79a_
    complexed with ca, hem

Details for d6dhzc_

PDB Entry: 6dhz (more details), 2.8 Å

PDB Description: crystallographic octamer of a metal-free ridc1 variant bearing two disulfide bonded cysteines
PDB Compounds: (C:) Soluble cytochrome b562

SCOPe Domain Sequences for d6dhzc_:

Sequence, based on SEQRES records: (download)

>d6dhzc_ a.24.3.1 (C:) Cytochrome b562 {Escherichia coli [TaxId: 562]}
adlednmetlndnlkviekadnaaqvkdaltkmaaaacdawsatppkledkspdspemhd
frhgfwiligqihdalhlanegkvkeaqaaaeqlkctcnachqkyr

Sequence, based on observed residues (ATOM records): (download)

>d6dhzc_ a.24.3.1 (C:) Cytochrome b562 {Escherichia coli [TaxId: 562]}
adlednmetlndnlkviekadnaaqvkdaltkmaaaacdawsatspdspemhdfrhgfwi
ligqihdalhlanegkvkeaqaaaeqlkctcnachqkyr

SCOPe Domain Coordinates for d6dhzc_:

Click to download the PDB-style file with coordinates for d6dhzc_.
(The format of our PDB-style files is described here.)

Timeline for d6dhzc_:

  • d6dhzc_ appears in periodic updates to SCOPe 2.07 starting on 2018-07-25