Lineage for d6dhzc_ (6dhz C:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. Superfamily a.24.3: Cytochromes [47175] (3 families) (S)
    Heme-containing proteins
  5. Family a.24.3.1: Cytochrome b562 [47176] (2 proteins)
    automatically mapped to Pfam PF07361
  6. Protein Cytochrome b562 [47177] (1 species)
  7. Species Escherichia coli [TaxId:562] [47178] (75 PDB entries)
  8. Domain d6dhzc_: 6dhz C: [355119]
    automated match to d3m79a_
    complexed with ca, hec

Details for d6dhzc_

PDB Entry: 6dhz (more details), 2.8 Å

PDB Description: crystallographic octamer of a metal-free ridc1 variant bearing two disulfide bonded cysteines
PDB Compounds: (C:) Soluble cytochrome b562

SCOPe Domain Sequences for d6dhzc_:

Sequence, based on SEQRES records: (download)

>d6dhzc_ a.24.3.1 (C:) Cytochrome b562 {Escherichia coli [TaxId: 562]}
adlednmetlndnlkviekadnaaqvkdaltkmaaaacdawsatppkledkspdspemhd
frhgfwiligqihdalhlanegkvkeaqaaaeqlkctcnachqkyr

Sequence, based on observed residues (ATOM records): (download)

>d6dhzc_ a.24.3.1 (C:) Cytochrome b562 {Escherichia coli [TaxId: 562]}
adlednmetlndnlkviekadnaaqvkdaltkmaaaacdawsatspdspemhdfrhgfwi
ligqihdalhlanegkvkeaqaaaeqlkctcnachqkyr

SCOPe Domain Coordinates for d6dhzc_ are not available.

Timeline for d6dhzc_:

Domains from other chains:
(mouse over for more information)
d6dhza_, d6dhzb_, d6dhzd_