Class a: All alpha proteins [46456] (289 folds) |
Fold a.177: Sigma2 domain of RNA polymerase sigma factors [88945] (1 superfamily) multihelical; consists of a conserved 4-helical core and a variable insert subdomain |
Superfamily a.177.1: Sigma2 domain of RNA polymerase sigma factors [88946] (2 families) |
Family a.177.1.1: Sigma2 domain of RNA polymerase sigma factors [88947] (6 proteins) |
Protein Sigma70 [88948] (2 species) |
Species Thermus thermophilus [TaxId:274] [88949] (11 PDB entries) Uniprot Q9WX78 |
Domain d6cuuf1: 6cuu F:78-257 [355106] Other proteins in same PDB: d6cuua1, d6cuua2, d6cuub1, d6cuub2, d6cuuc_, d6cuud_, d6cuue_, d6cuuf2, d6cuuf3 automated match to d1smyf3 protein/DNA complex; protein/RNA complex; complexed with kng, mg, zn |
PDB Entry: 6cuu (more details), 2.99 Å
SCOPe Domain Sequences for d6cuuf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6cuuf1 a.177.1.1 (F:78-257) Sigma70 {Thermus thermophilus [TaxId: 274]} sdpvrqylheigqvplltleeevelarkveegmeaikklseitgldpdlirevvrakilg sarvrhipglketldpktveeidqklkslpkehkrylhiaregeaarqhlieanlrlvvs iakkytgrglsfldliqegnqgliravekfeykrrfkfstyatwwirqainraiadqart
Timeline for d6cuuf1: