Lineage for d6ce2b_ (6ce2 B:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. Protein automated matches [190139] (27 species)
    not a true protein
  7. Species Bothrops moojeni [TaxId:98334] [188126] (13 PDB entries)
  8. Domain d6ce2b_: 6ce2 B: [355100]
    automated match to d3t0ra_
    complexed with pe4, svr

Details for d6ce2b_

PDB Entry: 6ce2 (more details), 2.15 Å

PDB Description: crystal structure of myotoxin i (mjtx-i) from bothrops moojeni complexed to inhibitor suramin
PDB Compounds: (B:) Basic phospholipase A2 homolog 1

SCOPe Domain Sequences for d6ce2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ce2b_ a.133.1.2 (B:) automated matches {Bothrops moojeni [TaxId: 98334]}
slvelgkmilqetgknpvksygaygcncgvlgrgkpkdatdrccyvhkccykkltncnpk
kdrysydwknktivcgeenpclkqlcecdkavaiclrenkgtynkkrdvylkpfcdkgrd
c

SCOPe Domain Coordinates for d6ce2b_ are not available.

Timeline for d6ce2b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6ce2a_