| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily) contains mixed beta-sheet |
Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families) ![]() |
| Family d.118.1.1: N-acetylmuramoyl-L-alanine amidase-like [55847] (11 proteins) Family 2 zinc amidase; |
| Protein automated matches [190549] (4 species) not a true protein |
| Species Camel (Camelus dromedarius) [TaxId:9838] [188016] (40 PDB entries) |
| Domain d6a89c_: 6a89 C: [355087] automated match to d3ng4a_ complexed with api, edo, gol, rib, tla |
PDB Entry: 6a89 (more details), 2.11 Å
SCOPe Domain Sequences for d6a89c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6a89c_ d.118.1.1 (C:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
acgsivprrewralasecrerltrpvryvvvshtagshcdtpascaqqaqnvqsyhvrnl
gwcdvgynfligedglvyegrgwnikgahagptwnpisigisfmgnymnrvpppralraa
qnllacgvalgalrsnyevkghrdvqptlspgdrlyeiiqtwshyra
Timeline for d6a89c_: