Lineage for d5xzdf_ (5xzd F:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2435650Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2435651Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2436644Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2436645Protein automated matches [190246] (70 species)
    not a true protein
  7. 3054935Species Roseovarius nubinhibens [TaxId:89187] [354997] (1 PDB entry)
  8. 3055022Domain d5xzdf_: 5xzd F: [355084]
    automated match to d3h81a_
    complexed with acy

Details for d5xzdf_

PDB Entry: 5xzd (more details), 1.9 Å

PDB Description: structure of acryloyl-coa hydratase acuh from roseovarius nubinhibens ism
PDB Compounds: (F:) enoyl-coa hydratase

SCOPe Domain Sequences for d5xzdf_:

Sequence, based on SEQRES records: (download)

>d5xzdf_ c.14.1.0 (F:) automated matches {Roseovarius nubinhibens [TaxId: 89187]}
yetiivevedhvalitlnrpdalnalndqllselvkaledaqnndkvrcivitgsekafa
agadikmmseksfvdvfagdlfgpeaegimrirkpiiaavsgyalgggcelammcdfiic
sdtakfgqpeinlgviagmggsqrltrfigksksmdmnltgrfmdaeeaersglvsrvvp
akklmeetmtaaqkiaeksmiavmavkeavnrsyevplregllferrvfqslf

Sequence, based on observed residues (ATOM records): (download)

>d5xzdf_ c.14.1.0 (F:) automated matches {Roseovarius nubinhibens [TaxId: 89187]}
yetiivevedhvalitlnrpdalnalndqllselvkaledaqnndkvrcivitgsekafa
agaagdlfgpeaegimrirkpiiaavsgyalgggcelammcdfiicsdtakfgqpeinlg
viagmggsqrltrfigksksmdmnltgrfmdaeeaersglvsrvvpakklmeetmtaaqk
iaeksmiavmavkeavnrsyevplregllferrvfqslf

SCOPe Domain Coordinates for d5xzdf_:

Click to download the PDB-style file with coordinates for d5xzdf_.
(The format of our PDB-style files is described here.)

Timeline for d5xzdf_:

  • d5xzdf_ is new in SCOPe 2.07-stable