SCOPe 2.07: Domain d5wjad2: 5wja D:199-355

Lineage for d5wjad2 (5wja D:199-355)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.1: PHM/PNGase F [49742] (2 families)
   members of this superfamily bind peptide substrates
   duplication: consists of two domains of this fold packed together like the adjacent nucleoplasmin subunits

5. Family b.121.1.2: Peptidylglycine alpha-hydroxylating monooxygenase, PHM [49746] (1 protein)

6. Protein Peptidylglycine alpha-hydroxylating monooxygenase, PHM [63402] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [49748] (26 PDB entries)

8. Domain d5wjad2: 5wja D:199-355 [355059]
   automated match to d1phma2
   complexed with cu, flc, gol, ni

Details for d5wjad2

PDB Entry: 5wja, 2.3 Å

PDB Description: crystal structure of h107a peptidylglycine alpha-hydroxylating monooxygenase (phm) in complex with citrate

PDB Compounds: (D:) Peptidyl-glycine alpha-amidating monooxygenase

SCOPe Domain Sequences for d5wjad2:

Sequence; same for both SEQRES and ATOM records:

>d5wjad2 b.121.1.2 (D:199-355) Peptidylglycine alpha-hydroxylating monooxygenase, PHM {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pliagmylmmsvdtvippgekvvnadiscqykmypmhvfayrvhthhlgkvvsgyrvrng
qwtligrqnpqlpqafypvehpvdvtfgdilaarcvftgegrteathiggtssdemcnly
imyymeakyalsfmtctknvapdmfrtipaeanipip

Timeline for d5wjad2:

• d5wjad2 is new in SCOPe 2.07-stable
  
• d5wjad2 appears in the current release, SCOPe 2.08