Lineage for d5vx4a1 (5vx4 A:64-223)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2375103Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2375104Protein automated matches [190437] (63 species)
    not a true protein
  7. 2375619Species Rotavirus a [TaxId:28875] [277665] (10 PDB entries)
  8. 3054994Domain d5vx4a1: 5vx4 A:64-223 [355056]
    Other proteins in same PDB: d5vx4a2
    automated match to d2aena_
    complexed with trs

Details for d5vx4a1

PDB Entry: 5vx4 (more details), 1.55 Å

PDB Description: vp8* of a g2p[4] human rotavirus
PDB Compounds: (A:) Outer capsid protein VP4

SCOPe Domain Sequences for d5vx4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vx4a1 b.29.1.0 (A:64-223) automated matches {Rotavirus a [TaxId: 28875]}
ildgpyqpttfkppndywllissntdgvvyestnnsdfwtaviavephvsqtnrqyvlfg
enkqfnvenssdkwkffemfkgssqsdfsnrrtltsnnrlvgmlkyggrvwtfhgetpra
ttdssntadlnnisiiihsefyiiprsqeskcneyinngl

SCOPe Domain Coordinates for d5vx4a1:

Click to download the PDB-style file with coordinates for d5vx4a1.
(The format of our PDB-style files is described here.)

Timeline for d5vx4a1:

  • d5vx4a1 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d5vx4a2