Lineage for d5y0cb_ (5y0c B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2310256Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2310257Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2310258Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2310580Protein Histone H4 [47125] (7 species)
  7. 2310581Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (46 PDB entries)
  8. 3054993Domain d5y0cb_: 5y0c B: [355055]
    Other proteins in same PDB: d5y0cc_, d5y0cd_, d5y0cg_
    automated match to d1kx5b_
    protein/DNA complex; complexed with cl, mn

Details for d5y0cb_

PDB Entry: 5y0c (more details), 2.09 Å

PDB Description: crystal structure of the human nucleosome at 2.09 angstrom resolution
PDB Compounds: (B:) histone h4

SCOPe Domain Sequences for d5y0cb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5y0cb_ a.22.1.1 (B:) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
niqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvtam
dvvyalkrqgrtlygfg

SCOPe Domain Coordinates for d5y0cb_:

Click to download the PDB-style file with coordinates for d5y0cb_.
(The format of our PDB-style files is described here.)

Timeline for d5y0cb_:

  • d5y0cb_ appears in periodic updates to SCOPe 2.07 starting on 2018-07-19