Lineage for d5zwha_ (5zwh A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335122Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2335123Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2335124Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2336099Protein Vitamin D nuclear receptor [48528] (2 species)
  7. 2336128Species Norway rat (Rattus norvegicus) [TaxId:10116] [101432] (25 PDB entries)
  8. 3054988Domain d5zwha_: 5zwh A: [355050]
    automated match to d1ie9a_
    complexed with 9kx, 9n9

Details for d5zwha_

PDB Entry: 5zwh (more details), 2.38 Å

PDB Description: covalent bond formation between histidine of vitamin d receptor (vdr) and a full agonist having an ene-ynone group via conjugate addition reaction
PDB Compounds: (A:) Vitamin D3 receptor

SCOPe Domain Sequences for d5zwha_:

Sequence, based on SEQRES records: (download)

>d5zwha_ a.123.1.1 (A:) Vitamin D nuclear receptor {Norway rat (Rattus norvegicus) [TaxId: 10116]}
klseeqqhiiailldahhktydptyadfrdfrppvrmdgstgsvtldlsplsmlphladl
vsysiqkvigfakmipgfrdltsddqivllkssaievimlrsnqsftmddmswdcgsqdy
kydvtdvskaghtlelieplikfqvglkklnlheeehvllmaicivspdrpgvqdaklve
aiqdrlsntlqtyircrhpppgshqlyakmiqkladlrslneehskqyrslsfqpensmk
ltplvlevfgn

Sequence, based on observed residues (ATOM records): (download)

>d5zwha_ a.123.1.1 (A:) Vitamin D nuclear receptor {Norway rat (Rattus norvegicus) [TaxId: 10116]}
klseeqqhiiailldahhktydptyadfrdfrppvrlsmlphladlvsysiqkvigfakm
ipgfrdltsddqivllkssaievimlrsnqsftmddmswdcgsqdykydvtdvskaghtl
elieplikfqvglkklnlheeehvllmaicivspdrpgvqdaklveaiqdrlsntlqtyi
rcrhpppgshqlyakmiqkladlrslneehskqyrslsfqpensmkltplvlevfgn

SCOPe Domain Coordinates for d5zwha_:

Click to download the PDB-style file with coordinates for d5zwha_.
(The format of our PDB-style files is described here.)

Timeline for d5zwha_:

  • d5zwha_ appears in periodic updates to SCOPe 2.07 starting on 2018-07-19