SCOPe 2.07: Domain d5xz2a_: 5xz2 A:

Lineage for d5xz2a_ (5xz2 A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (156 species)
   not a true protein

7. Species Danio rerio [TaxId:7955] [355038] (1 PDB entry)

8. Domain d5xz2a_: 5xz2 A: [355039]
   automated match to d2bwja_
   complexed with ap5, so4

Details for d5xz2a_

PDB Entry: 5xz2, 1.75 Å

PDB Description: crystal structure of adenylate kinase

PDB Compounds: (A:) adenylate kinase isoenzyme 1

SCOPe Domain Sequences for d5xz2a_:

Sequence; same for both SEQRES and ATOM records:

>d5xz2a_ c.37.1.0 (A:) automated matches {Danio rerio [TaxId: 7955]}
adkiknakivfvvggpgsgkgtqcekivakygythlssgdllraevasgsergkqlqaim
qkgelvpldtvldmikdamiakadvskgylidgyprevkqgeefekkigapalllyidak
getmvkrlmkrgetsgraddneetikkrldlyykatepviafyeqrgivrkinselpvde
vfaivekaidel

Timeline for d5xz2a_:

• d5xz2a_ is new in SCOPe 2.07-stable
  
• d5xz2a_ appears in the current release, SCOPe 2.08