Lineage for d5z30d_ (5z30 D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2310256Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2310257Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2310258Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2310745Protein automated matches [193445] (6 species)
    not a true protein
  7. 2310800Species Human (Homo sapiens) [TaxId:9606] [193446] (51 PDB entries)
  8. 3054959Domain d5z30d_: 5z30 D: [355021]
    Other proteins in same PDB: d5z30b_, d5z30c_, d5z30f_, d5z30g_
    automated match to d1kx5d_
    protein/DNA complex; complexed with cl, mn; mutant

Details for d5z30d_

PDB Entry: 5z30 (more details), 2.45 Å

PDB Description: the crystal structure of the nucleosome containing a cancer-associated histone h2a.z r80c mutant
PDB Compounds: (D:) Histone H2B type 1-J

SCOPe Domain Sequences for d5z30d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5z30d_ a.22.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiageasrlahynkrstits
reiqtavrlllpgelakhavsegtkavtkytsa

SCOPe Domain Coordinates for d5z30d_:

Click to download the PDB-style file with coordinates for d5z30d_.
(The format of our PDB-style files is described here.)

Timeline for d5z30d_:

  • d5z30d_ appears in periodic updates to SCOPe 2.07 starting on 2018-07-19