Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily) contains mixed beta-sheet |
Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families) |
Family d.118.1.0: automated matches [191348] (1 protein) not a true family |
Protein automated matches [190280] (10 species) not a true protein |
Species Honeybee (Apis mellifera) [TaxId:7460] [355009] (1 PDB entry) |
Domain d5xz3c_: 5xz3 C: [355010] Other proteins in same PDB: d5xz3a2 automated match to d1ycka1 complexed with so4 |
PDB Entry: 5xz3 (more details), 1.86 Å
SCOPe Domain Sequences for d5xz3c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xz3c_ d.118.1.0 (C:) automated matches {Honeybee (Apis mellifera) [TaxId: 7460]} eiikrnewtnvqakninyliipipyviihhtvslecnskdtcisnienirsyhmdtlnwh digysfliggdgniyegcgwnhegahtygynkksisiafignfqnksasnkmlnaahkli lcgkskgilredvrviggkqviatlspgfelykqiqnwpewvstp
Timeline for d5xz3c_:
View in 3D Domains from other chains: (mouse over for more information) d5xz3a1, d5xz3a2, d5xz3b_, d5xz3d_ |