Lineage for d5xz3c_ (5xz3 C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2972806Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily)
    contains mixed beta-sheet
  4. 2972807Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families) (S)
  5. 2973039Family d.118.1.0: automated matches [191348] (1 protein)
    not a true family
  6. 2973040Protein automated matches [190280] (10 species)
    not a true protein
  7. 2973062Species Honeybee (Apis mellifera) [TaxId:7460] [355009] (1 PDB entry)
  8. 2973065Domain d5xz3c_: 5xz3 C: [355010]
    Other proteins in same PDB: d5xz3a2
    automated match to d1ycka1
    complexed with so4

Details for d5xz3c_

PDB Entry: 5xz3 (more details), 1.86 Å

PDB Description: the x-ray structure of apis mellifera pgrp-sa
PDB Compounds: (C:) Peptidoglycan-recognition protein

SCOPe Domain Sequences for d5xz3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xz3c_ d.118.1.0 (C:) automated matches {Honeybee (Apis mellifera) [TaxId: 7460]}
eiikrnewtnvqakninyliipipyviihhtvslecnskdtcisnienirsyhmdtlnwh
digysfliggdgniyegcgwnhegahtygynkksisiafignfqnksasnkmlnaahkli
lcgkskgilredvrviggkqviatlspgfelykqiqnwpewvstp

SCOPe Domain Coordinates for d5xz3c_:

Click to download the PDB-style file with coordinates for d5xz3c_.
(The format of our PDB-style files is described here.)

Timeline for d5xz3c_: