Lineage for d5xzda_ (5xzd A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. Protein automated matches [190246] (70 species)
    not a true protein
  7. Species Roseovarius nubinhibens [TaxId:89187] [354997] (1 PDB entry)
  8. Domain d5xzda_: 5xzd A: [355000]
    automated match to d3h81a_
    complexed with acy

Details for d5xzda_

PDB Entry: 5xzd (more details), 1.9 Å

PDB Description: structure of acryloyl-coa hydratase acuh from roseovarius nubinhibens ism
PDB Compounds: (A:) enoyl-coa hydratase

SCOPe Domain Sequences for d5xzda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xzda_ c.14.1.0 (A:) automated matches {Roseovarius nubinhibens [TaxId: 89187]}
yetiivevedhvalitlnrpdalnalndqllselvkaledaqnndkvrcivitgsekafa
agadikmmseksfvdvfagdlfgpeaegimrirkpiiaavsgyalgggcelammcdfiic
sdtakfgqpeinlgviagmggsqrltrfigksksmdmnltgrfmdaeeaersglvsrvvp
akklmeetmtaaqkiaeksmiavmavkeavnrsyevplregllferrvfqslf

SCOPe Domain Coordinates for d5xzda_ are not available.

Timeline for d5xzda_:

Domains from other chains:
(mouse over for more information)
d5xzdb_, d5xzdc_, d5xzdd_, d5xzde_, d5xzdf_