Lineage for d5vx9a1 (5vx9 A:65-223)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2375103Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2375104Protein automated matches [190437] (63 species)
    not a true protein
  7. 2375499Species Human rotavirus a [TaxId:10941] [187643] (13 PDB entries)
  8. 3054933Domain d5vx9a1: 5vx9 A:65-223 [354995]
    Other proteins in same PDB: d5vx9a2
    automated match to d5caza_
    complexed with bgc, fuc, gal, nag, so4

Details for d5vx9a1

PDB Entry: 5vx9 (more details), 1.82 Å

PDB Description: vp8* of p[6] human rotavirus rv3 in complex with lnfp1
PDB Compounds: (A:) Outer capsid protein VP4

SCOPe Domain Sequences for d5vx9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vx9a1 b.29.1.0 (A:65-223) automated matches {Human rotavirus a [TaxId: 10941]}
ldgpyqstsfkppsdywillnptnqqvvlegtnktdiwvalllvepnvtnqsrqytlfge
tkqitvenntnkwkffemfrssvsaefqhkrtltsdtklagflkhynsvwtfhgetphat
tdysstsnlsevettihvefyiiprsqeskcveyintgl

SCOPe Domain Coordinates for d5vx9a1:

Click to download the PDB-style file with coordinates for d5vx9a1.
(The format of our PDB-style files is described here.)

Timeline for d5vx9a1:

  • d5vx9a1 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d5vx9a2