Lineage for d5vx8a_ (5vx8 A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2375103Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2375104Protein automated matches [190437] (63 species)
    not a true protein
  7. 2375499Species Human rotavirus a [TaxId:10941] [187643] (13 PDB entries)
  8. 3054927Domain d5vx8a_: 5vx8 A: [354989]
    automated match to d5caza_
    complexed with so4

Details for d5vx8a_

PDB Entry: 5vx8 (more details), 2 Å

PDB Description: vp8* of p[6] human rotavirus rv3
PDB Compounds: (A:) Outer capsid protein VP4

SCOPe Domain Sequences for d5vx8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vx8a_ b.29.1.0 (A:) automated matches {Human rotavirus a [TaxId: 10941]}
ldgpyqstsfkppsdywillnptnqqvvlegtnktdiwvalllvepnvtnqsrqytlfge
tkqitvenntnkwkffemfrssvsaefqhkrtltsdtklagflkhynsvwtfhgetphat
tdysstsnlsevettihvefyiiprsqeskcveyintgl

SCOPe Domain Coordinates for d5vx8a_:

Click to download the PDB-style file with coordinates for d5vx8a_.
(The format of our PDB-style files is described here.)

Timeline for d5vx8a_:

  • d5vx8a_ is new in SCOPe 2.07-stable