Lineage for d5qida_ (5qid A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2414849Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2415386Family c.1.4.0: automated matches [191310] (1 protein)
    not a true family
  6. 2415387Protein automated matches [190048] (31 species)
    not a true protein
  7. 2415456Species Human (Homo sapiens) [TaxId:9606] [189110] (16 PDB entries)
  8. 3054921Domain d5qida_: 5qid A: [354983]
    automated match to d2rdua_
    complexed with fmn, gwy

Details for d5qida_

PDB Entry: 5qid (more details), 1.45 Å

PDB Description: pandda analysis group deposition of models with modelled events (e.g. bound ligands) -- crystal structure of hao1 in complex with z1787627869
PDB Compounds: (A:) hydroxyacid oxidase 1

SCOPe Domain Sequences for d5qida_:

Sequence, based on SEQRES records: (download)

>d5qida_ c.1.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rlicindyeqhaksvlpksiydyyrsgandeetladniaafsrwklyprmlrnvaetdls
tsvlgqrvsmpicvgatamqrmahvdgelatvracqslgtgmmlsswatssieevaeagp
ealrwlqlyiykdrevtkklvrqaekmgykaifvtvdtpylgnrlddvrnrfklppqlrm
knfetstlsfspeenfgddsglaayvakaidpsiswedikwlrrltslpivakgilrgdd
areavkhglngilvsnhgarqldgvpatidvlpeiveavegkvevfldggvrkgtdvlka
lalgakavfvgrpivwglafqgekgvqdvleilkeefrlamalsgcqnvkvidktlvrk

Sequence, based on observed residues (ATOM records): (download)

>d5qida_ c.1.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rlicindyeqhaksvlpksiydyyrsgandeetladniaafsrwklyprmlrnvaetdls
tsvlgqrvsmpicvgatamqrmahvdgelatvracqslgtgmmlsswatssieevaeagp
ealrwlqlyiykdrevtkklvrqaekmgykaifvtvdtpylgnrlddvrnrfklppqlrm
knfdsglaayvakaidpsiswedikwlrrltslpivakgilrgddareavkhglngilvs
nhgarqldgvpatidvlpeiveavegkvevfldggvrkgtdvlkalalgakavfvgrpiv
wglafqgekgvqdvleilkeefrlamalsgcqnvkvidktlvrk

SCOPe Domain Coordinates for d5qida_:

Click to download the PDB-style file with coordinates for d5qida_.
(The format of our PDB-style files is described here.)

Timeline for d5qida_:

  • d5qida_ is new in SCOPe 2.07-stable