SCOPe 2.08: Domain d6fzub_: 6fzu B:

Lineage for d6fzub_ (6fzu B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.0: automated matches [191623] (1 protein)
   not a true family

6. Protein automated matches [191142] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189274] (121 PDB entries)

8. Domain d6fzub_: 6fzu B: [354973]
   automated match to d3l0la_
   complexed with ee8

Details for d6fzub_

PDB Entry: 6fzu, 1.8 Å

PDB Description: rorgt (264-518;c455s) in complex with the fragment ("cpd-1") and rip140 peptide at 1.80a

PDB Compounds: (B:) Nuclear receptor ROR-gamma

SCOPe Domain Sequences for d6fzub_:

Sequence; same for both SEQRES and ATOM records:

>d6fzub_ a.123.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahh
lteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyg
gmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlq
ynlelafhhhlskthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafpplyk
elfst

Timeline for d6fzub_:

• d6fzub_ first appeared in SCOPe 2.07