SCOPe 2.08: Domain d6gqda2: 6gqd A:198-368

Lineage for d6gqda2 (6gqd A:198-368)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.13: HIT-like [54196] (2 superfamilies)
   alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha

4. Superfamily d.13.1: HIT-like [54197] (6 families)

5. Family d.13.1.2: Hexose-1-phosphate uridylyltransferase [54207] (1 protein)
   duplication: consists of 2 HIT-like motifs
   binds zinc and iron ions

6. Protein Galactose-1-phosphate uridylyltransferase [54208] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [315092] (2 PDB entries)

8. Domain d6gqda2: 6gqd A:198-368 [354972]
   automated match to d1guqa2
   complexed with edo, h2u, zn; mutant

Details for d6gqda2

PDB Entry: 6gqd, 1.52 Å

PDB Description: structure of human galactose-1-phosphate uridylyltransferase (galt), with crystallization epitope mutations a21y:a22t:t23p:r25l

PDB Compounds: (A:) galactose-1-phosphate uridylyltransferase

SCOPe Domain Sequences for d6gqda2:

Sequence; same for both SEQRES and ATOM records:

>d6gqda2 d.13.1.2 (A:198-368) Galactose-1-phosphate uridylyltransferase {Human (Homo sapiens) [TaxId: 9606]}
iaqreersqqayksqhgepllmeysrqellrkerlvltsehwlvlvpfwatwpyqtlllp
rrhvrrlpeltpaerddlasimkklltkydnlfetsfpysmgwhgaptgseaganwdhwq
lhahyyppllrsatvrkfmvgyemlaqaqrdltpeqaaerlralpevhyhl

Timeline for d6gqda2:

• d6gqda2 first appeared in SCOPe 2.07