Lineage for d6gqda2 (6gqd A:198-368)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2499927Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 2499928Superfamily d.13.1: HIT-like [54197] (6 families) (S)
  5. 2500083Family d.13.1.2: Hexose-1-phosphate uridylyltransferase [54207] (1 protein)
    duplication: consists of 2 HIT-like motifs
    binds zinc and iron ions
  6. 2500084Protein Galactose-1-phosphate uridylyltransferase [54208] (3 species)
  7. 2500110Species Human (Homo sapiens) [TaxId:9606] [315092] (2 PDB entries)
  8. 3054910Domain d6gqda2: 6gqd A:198-368 [354972]
    automated match to d1guqa2
    complexed with edo, h2u, zn; mutant

Details for d6gqda2

PDB Entry: 6gqd (more details), 1.52 Å

PDB Description: structure of human galactose-1-phosphate uridylyltransferase (galt), with crystallization epitope mutations a21y:a22t:t23p:r25l
PDB Compounds: (A:) galactose-1-phosphate uridylyltransferase

SCOPe Domain Sequences for d6gqda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gqda2 d.13.1.2 (A:198-368) Galactose-1-phosphate uridylyltransferase {Human (Homo sapiens) [TaxId: 9606]}
iaqreersqqayksqhgepllmeysrqellrkerlvltsehwlvlvpfwatwpyqtlllp
rrhvrrlpeltpaerddlasimkklltkydnlfetsfpysmgwhgaptgseaganwdhwq
lhahyyppllrsatvrkfmvgyemlaqaqrdltpeqaaerlralpevhyhl

SCOPe Domain Coordinates for d6gqda2:

Click to download the PDB-style file with coordinates for d6gqda2.
(The format of our PDB-style files is described here.)

Timeline for d6gqda2:

  • d6gqda2 appears in periodic updates to SCOPe 2.07 starting on 2018-07-19

View in 3D
Domains from same chain:
(mouse over for more information)
d6gqda1