Lineage for d6gplb_ (6gpl B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2842441Protein GDP-mannose 4,6-dehydratase [51759] (4 species)
  7. 2842444Species Human (Homo sapiens) [TaxId:9606] [102135] (7 PDB entries)
  8. 2842457Domain d6gplb_: 6gpl B: [354955]
    automated match to d1t2aa_
    complexed with bcn, edo, f7e, nap

    has additional subdomain(s) that are not in the common domain

Details for d6gplb_

PDB Entry: 6gpl (more details), 1.76 Å

PDB Description: crystal structure of human gdp-d-mannose 4,6-dehydratase in complex with gdp-4k6d-man
PDB Compounds: (B:) GDP-mannose 4,6 dehydratase

SCOPe Domain Sequences for d6gplb_:

Sequence, based on SEQRES records: (download)

>d6gplb_ c.2.1.2 (B:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]}
rnvalitgitgqdgsylaefllekgyevhgivrrsssfntgriehlyknpqahiegnmkl
hygdltdstclvkiinevkpteiynlgaqshvkisfdlaeytadvdgvgtlrlldavktc
glinsvkfyqastselygkvqeipqkettpfyprspygaaklyaywivvnfreaynlfav
ngilfnhesprrganfvtrkisrsvakiylgqlecfslgnldakrdwghakdyveamwlm
lqndepedfviatgevhsvrefveksflhigktivwegknenevgrcketgkvhvtvdlk
yyrptevdflqgdctkakqklnwkprvafdelvremvhadvelmrtnpna

Sequence, based on observed residues (ATOM records): (download)

>d6gplb_ c.2.1.2 (B:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]}
rnvalitgitgqdgsylaefllekgyevhgivrrsssfntgriehlygnmklhygdltds
tclvkiinevkpteiynlgaqshvkisfdlaeytadvdgvgtlrlldavktcglinsvkf
yqastselygkvqeipqkettpfyprspygaaklyaywivvnfreaynlfavngilfnhe
sprrganfvtrkisrsvakiylgqlecfslgnldakrdwghakdyveamwlmlqndeped
fviatgevhsvrefveksflhigktivwegknenevgrcketgkvhvtvdlkyyrptevd
flqgdctkakqklnwkprvafdelvremvhadvelmrtnpna

SCOPe Domain Coordinates for d6gplb_:

Click to download the PDB-style file with coordinates for d6gplb_.
(The format of our PDB-style files is described here.)

Timeline for d6gplb_: