Lineage for d6bvab_ (6bva B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. Protein automated matches [190233] (31 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187090] (155 PDB entries)
  8. Domain d6bvab_: 6bva B: [354950]
    Other proteins in same PDB: d6bvaa2, d6bvac1, d6bvac2, d6bvad1, d6bvad2, d6bvad3
    automated match to d5v6ab_

Details for d6bvab_

PDB Entry: 6bva (more details), 2.66 Å

PDB Description: ubiquitin variant (ubv.fl10.1) bound to a human skp1-fbl10 fragment complex.
PDB Compounds: (B:) Polyubiquitin-B

SCOPe Domain Sequences for d6bvab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bvab_ d.15.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gmqifvktfrdrlrnllpqtitlevepsdtienvkakiqdkegippdqqvlifsrkrled
grtlsdyniqkestlrlvlvf

SCOPe Domain Coordinates for d6bvab_ are not available.

Timeline for d6bvab_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6bvaa1, d6bvaa2, d6bvac1, d6bvac2, d6bvad1, d6bvad2, d6bvad3