SCOPe 2.08: Domain d6gzpa1: 6gzp A:1-111

Lineage for d6gzpa1 (6gzp A:1-111)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [189241] (37 PDB entries)

8. Domain d6gzpa1: 6gzp A:1-111 [354941]
   Other proteins in same PDB: d6gzpa2
   automated match to d3cx5j_

Details for d6gzpa1

PDB Entry: 6gzp, 2.1 Å

PDB Description: llama nanobody porm_02 structure determined at room temperature by in- situ diffraction in chipx microfluidic device

PDB Compounds: (A:) Nanobody

SCOPe Domain Sequences for d6gzpa1:

Sequence; same for both SEQRES and ATOM records:

>d6gzpa1 b.1.1.0 (A:1-111) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlvesggglvqagdslrlscaasgltfnrynmgwfrqapgrerefvasiswsgdrtyg
tdsvkgrfaisrdnakntmylqmnslkpedtavyycaadrfltrsvkydywgqgtqvtv

Timeline for d6gzpa1:

• d6gzpa1 first appeared in SCOPe 2.07