SCOPe 2.08: Domain d6gbva1: 6gbv A:20-138

Lineage for d6gbva1 (6gbv A:20-138)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.0: automated matches [191387] (1 protein)
   not a true family

6. Protein automated matches [190492] (24 species)
   not a true protein

7. Species Dinoroseobacter shibae [TaxId:398580] [261211] (6 PDB entries)

8. Domain d6gbva1: 6gbv A:20-138 [354938]
   Other proteins in same PDB: d6gbva2
   automated match to d5dkla_
   complexed with fmn, po4; mutant

Details for d6gbva1

PDB Entry: 6gbv, 1.63 Å

PDB Description: a fast recovering full-length lov protein (dslov) from the marine phototrophic bacterium dinoroseobacter shibae (dark state) - m49t mutant

PDB Compounds: (A:) Putative blue-light photoreceptor

SCOPe Domain Sequences for d6gbva1:

Sequence; same for both SEQRES and ATOM records:

>d6gbva1 d.110.3.0 (A:20-138) automated matches {Dinoroseobacter shibae [TaxId: 398580]}
diadlralldedeaemsvvfsdpsqpdnptiyvsdaflvqtgytleevlgrncrflqgpd
tnphaveairqglkaetrftidilnyrkdgsafvnrlrirpiydpegnlmffagaqnpv

Timeline for d6gbva1:

• d6gbva1 first appeared in SCOPe 2.07