Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) alpha-beta(2)-alpha(2)-beta(3) |
Family d.110.3.0: automated matches [191387] (1 protein) not a true family |
Protein automated matches [190492] (24 species) not a true protein |
Species Dinoroseobacter shibae [TaxId:398580] [261211] (6 PDB entries) |
Domain d6gaya1: 6gay A:32-138 [354927] Other proteins in same PDB: d6gaya2, d6gayb2 automated match to d5dkla_ complexed with fmn, so4; mutant |
PDB Entry: 6gay (more details), 1.86 Å
SCOPe Domain Sequences for d6gaya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6gaya1 d.110.3.0 (A:32-138) automated matches {Dinoroseobacter shibae [TaxId: 398580]} eaemsvvfsdpsqpdnpiiyvsdaflvqtgytleevlgrncrflqgpdtnphaveairqg lkaetrftidilnyrkdgsafvnrlrirpiydpegnlmffagaqnpv
Timeline for d6gaya1: