![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
![]() | Protein automated matches [190233] (31 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187090] (152 PDB entries) |
![]() | Domain d6bvaa1: 6bva A:0-76 [354912] Other proteins in same PDB: d6bvaa2, d6bvac1, d6bvac2, d6bvad1, d6bvad2, d6bvad3 automated match to d5v6ab_ |
PDB Entry: 6bva (more details), 2.66 Å
SCOPe Domain Sequences for d6bvaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6bvaa1 d.15.1.0 (A:0-76) automated matches {Human (Homo sapiens) [TaxId: 9606]} gmqifvktfrdrlrnllpqtitlevepsdtienvkakiqdkegippdqqvlifsrkrled grtlsdyniqkestlrlvlvfgrr
Timeline for d6bvaa1: