SCOPe 2.07: Domain d6dbfb_: 6dbf B:

Lineage for d6dbfb_ (6dbf B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Camel (Camelus dromedarius) [TaxId:9838] [276268] (8 PDB entries)

8. Domain d6dbfb_: 6dbf B: [354891]
   Other proteins in same PDB: d6dbfa_
   automated match to d4nbzb_

Details for d6dbfb_

PDB Entry: 6dbf, 1.55 Å

PDB Description: crystal structure of vhh r303 in complex with inlb-lrr

PDB Compounds: (B:) InlB specific VHH R303

SCOPe Domain Sequences for d6dbfb_:

Sequence, based on SEQRES records:

>d6dbfb_ b.1.1.0 (B:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
qvkleesgggsvqaggslrlscaasghtystycmgwfrqvpgkeregvarinvggsstwy
adsvrdrftisqdnakntvylqmnslkledtaiyyctlhrfcntwslgtlnvwgqgtqvt
vss

Sequence, based on observed residues (ATOM records):

>d6dbfb_ b.1.1.0 (B:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
qvkleesgggsvqaggslrlscaasghtystycmgwfrqvkeregvarinvggsstwyad
svrdrftisqdnakntvylqmnslkledtaiyyctlhrfcntwslgtlnvwgqgtqvtvs
s

Timeline for d6dbfb_:

• d6dbfb_ is new in SCOPe 2.07-stable
  
• d6dbfb_ appears in the current release, SCOPe 2.08