Lineage for d6drwa1 (6drw A:840-1131)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2546221Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2546222Protein automated matches [190417] (35 species)
    not a true protein
  7. 2546365Species Human (Homo sapiens) [TaxId:9606] [187294] (1319 PDB entries)
  8. 3054823Domain d6drwa1: 6drw A:840-1131 [354885]
    Other proteins in same PDB: d6drwa2
    automated match to d5j87b_
    complexed with ske

Details for d6drwa1

PDB Entry: 6drw (more details), 2.3 Å

PDB Description: jak2 jh1 in complex with jnj-7706621 (crystal form 2)
PDB Compounds: (A:) Tyrosine-protein kinase JAK2

SCOPe Domain Sequences for d6drwa1:

Sequence, based on SEQRES records: (download)

>d6drwa1 d.144.1.0 (A:840-1131) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dptqfeerhlkflqqlgkgnfgsvemcrydplqdntgevvavkklqhsteehlrdferei
eilkslqhdnivkykgvcysagrrnlklimeylpygslrdylqkhkeridhikllqytsq
ickgmeylgtkryihrdlatrnilvenenrvkigdfgltkvlpqdkeyykvkepgespif
wyapeslteskfsvasdvwsfgvvlyelftyieksksppaefmrmigndkqgqmivfhli
ellknngrlprpdgcpdeiymimtecwnnnvnqrpsfrdlalrvdqirdnma

Sequence, based on observed residues (ATOM records): (download)

>d6drwa1 d.144.1.0 (A:840-1131) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dptqfeerhlkflqqlgkfgsvemcrydplqdntgevvavkklqhsteehlrdfereiei
lkslqhdnivkykgvcysagrrnlklimeylpygslrdylqkhkeridhikllqytsqic
kgmeylgtkryihrdlatrnilvenenrvkigdfgltkvlpqdkeyykvkespifwyape
slteskfsvasdvwsfgvvlyelftyieksksppaefmrmigndkqgqmivfhliellkn
ngrlprpdgcpdeiymimtecwnnnvnqrpsfrdlalrvdqirdnma

SCOPe Domain Coordinates for d6drwa1:

Click to download the PDB-style file with coordinates for d6drwa1.
(The format of our PDB-style files is described here.)

Timeline for d6drwa1:

  • d6drwa1 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d6drwa2