SCOPe 2.08: Domain d6dbaa_: 6dba A:

Lineage for d6dbaa_ (6dba A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Camel (Camelus dromedarius) [TaxId:9838] [276268] (8 PDB entries)

8. Domain d6dbaa_: 6dba A: [354882]
   automated match to d4nbzb_

Details for d6dbaa_

PDB Entry: 6dba, 1.3 Å

PDB Description: crystal structure of vhh r303

PDB Compounds: (A:) nanobody VHH R303

SCOPe Domain Sequences for d6dbaa_:

Sequence; same for both SEQRES and ATOM records:

>d6dbaa_ b.1.1.0 (A:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
qvkleesgggsvqaggslrlscaasghtystycmgwfrqvpgkeregvarinvggsstwy
adsvrdrftisqdnakntvylqmnslkledtaiyyctlhrfcntwslgtlnvwgqgtqvt
vss

Timeline for d6dbaa_:

• d6dbaa_ first appeared in SCOPe 2.07