Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (309 species) not a true protein |
Species Klebsiella pneumoniae [TaxId:573] [225753] (5 PDB entries) |
Domain d6dvvb1: 6dvv B:2-167 [354870] Other proteins in same PDB: d6dvva2, d6dvva3, d6dvvb2, d6dvvb3 automated match to d1u8xx1 complexed with cl, gol, mn, nad, peg, so4 |
PDB Entry: 6dvv (more details), 2.25 Å
SCOPe Domain Sequences for d6dvvb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6dvvb1 c.2.1.0 (B:2-167) automated matches {Klebsiella pneumoniae [TaxId: 573]} kkfsvviagggstftpgivlmllanqdrfplrslkfydndgarqetiaeackvilkeqap eiefsyttdpqaaftdvdfvmahirvgkypmreqdekiplrhgvlgqetcgpggiaygmr siggvlelvdymekyspnawmlnysnpaaivaeatrrlrpnakiln
Timeline for d6dvvb1: