Lineage for d6dvvb1 (6dvv B:2-167)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2454167Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2454168Protein automated matches [190069] (309 species)
    not a true protein
  7. 2455794Species Klebsiella pneumoniae [TaxId:573] [225753] (5 PDB entries)
  8. 2455802Domain d6dvvb1: 6dvv B:2-167 [354870]
    Other proteins in same PDB: d6dvva2, d6dvva3, d6dvvb2, d6dvvb3
    automated match to d1u8xx1
    complexed with cl, gol, mn, nad, peg, so4

Details for d6dvvb1

PDB Entry: 6dvv (more details), 2.25 Å

PDB Description: 2.25 angstrom resolution crystal structure of 6-phospho-alpha- glucosidase from klebsiella pneumoniae in complex with nad and mn2+.
PDB Compounds: (B:) 6-phospho-alpha-glucosidase

SCOPe Domain Sequences for d6dvvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dvvb1 c.2.1.0 (B:2-167) automated matches {Klebsiella pneumoniae [TaxId: 573]}
kkfsvviagggstftpgivlmllanqdrfplrslkfydndgarqetiaeackvilkeqap
eiefsyttdpqaaftdvdfvmahirvgkypmreqdekiplrhgvlgqetcgpggiaygmr
siggvlelvdymekyspnawmlnysnpaaivaeatrrlrpnakiln

SCOPe Domain Coordinates for d6dvvb1:

Click to download the PDB-style file with coordinates for d6dvvb1.
(The format of our PDB-style files is described here.)

Timeline for d6dvvb1: