SCOPe 2.08: Domain d6d2qa3: 6d2q A:227-319

Lineage for d6d2qa3 (6d2q A:227-319)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.0: automated matches [191311] (1 protein)
   not a true family

6. Protein automated matches [190052] (8 species)
   not a true protein

7. Species Zebrafish (Danio rerio) [TaxId:7955] [354860] (2 PDB entries)

8. Domain d6d2qa3: 6d2q A:227-319 [354861]
   Other proteins in same PDB: d6d2qa1, d6d2qa2
   automated match to d2he7a3

Details for d6d2qa3

PDB Entry: 6d2q, 2.99 Å

PDB Description: crystal structure of the ferm domain of zebrafish farp1

PDB Compounds: (A:) FERM, RhoGEF (ARHGEF) and pleckstrin domain protein 1 (chondrocyte-derived)

SCOPe Domain Sequences for d6d2qa3:

Sequence, based on SEQRES records:

>d6d2qa3 b.55.1.0 (A:227-319) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
gvrlhpakdregtrlslavahsgvlvfqghtkinafnwskvrklsfkrkrfliklrpdln
sncqdtlefmmgsrdcckvfwkicveyhaffr

Sequence, based on observed residues (ATOM records):

>d6d2qa3 b.55.1.0 (A:227-319) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
gvrlhpakdregtrlslavahsgvlvfqghtkinafnwskvrklsfkrkrfliklrcqdt
lefmmgsrdcckvfwkicveyhaffr

Timeline for d6d2qa3:

• d6d2qa3 first appeared in SCOPe 2.07