Lineage for d6d2qa2 (6d2q A:123-226)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2309710Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
    core: 3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2309753Superfamily a.11.2: Second domain of FERM [47031] (2 families) (S)
    automatically mapped to Pfam PF00373
  5. 2309829Family a.11.2.0: automated matches [254193] (1 protein)
    not a true family
  6. 2309830Protein automated matches [254423] (4 species)
    not a true protein
  7. 3054792Species Danio rerio [TaxId:7955] [354854] (2 PDB entries)
  8. 3054793Domain d6d2qa2: 6d2q A:123-226 [354855]
    Other proteins in same PDB: d6d2qa1, d6d2qa3
    automated match to d2he7a2

Details for d6d2qa2

PDB Entry: 6d2q (more details), 2.99 Å

PDB Description: crystal structure of the ferm domain of zebrafish farp1
PDB Compounds: (A:) FERM, RhoGEF (ARHGEF) and pleckstrin domain protein 1 (chondrocyte-derived)

SCOPe Domain Sequences for d6d2qa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6d2qa2 a.11.2.0 (A:123-226) automated matches {Danio rerio [TaxId: 7955]}
pdhtqlleeltrylfalqikhdlacgrltcnessaallvahivqseigdfdevqckqhll
nnkyipeqdtlmdkiigyhrkhvgqtpaesdyqlleiarrlemy

SCOPe Domain Coordinates for d6d2qa2:

Click to download the PDB-style file with coordinates for d6d2qa2.
(The format of our PDB-style files is described here.)

Timeline for d6d2qa2:

  • d6d2qa2 appears in periodic updates to SCOPe 2.07 starting on 2018-07-19