![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies) core: 3 helices; bundle, closed, left-handed twist; up-and-down |
![]() | Superfamily a.11.2: Second domain of FERM [47031] (2 families) ![]() automatically mapped to Pfam PF00373 |
![]() | Family a.11.2.0: automated matches [254193] (1 protein) not a true family |
![]() | Protein automated matches [254423] (5 species) not a true protein |
![]() | Species Zebrafish (Danio rerio) [TaxId:7955] [354854] (2 PDB entries) |
![]() | Domain d6d2qa2: 6d2q A:123-226 [354855] Other proteins in same PDB: d6d2qa1, d6d2qa3 automated match to d2he7a2 |
PDB Entry: 6d2q (more details), 2.99 Å
SCOPe Domain Sequences for d6d2qa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6d2qa2 a.11.2.0 (A:123-226) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]} pdhtqlleeltrylfalqikhdlacgrltcnessaallvahivqseigdfdevqckqhll nnkyipeqdtlmdkiigyhrkhvgqtpaesdyqlleiarrlemy
Timeline for d6d2qa2: