![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
![]() | Protein automated matches [190233] (31 species) not a true protein |
![]() | Species Zebrafish (Danio rerio) [TaxId:7955] [338846] (3 PDB entries) |
![]() | Domain d6d2qa1: 6d2q A:38-122 [354853] Other proteins in same PDB: d6d2qa2, d6d2qa3 automated match to d2he7a1 |
PDB Entry: 6d2q (more details), 2.99 Å
SCOPe Domain Sequences for d6d2qa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6d2qa1 d.15.1.0 (A:38-122) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]} grqisirvqmlddtqevfevsqrapgkalfdlvcshlnlvegdyfglefqdqrkmivwld llkpilkqirrpkniilrfvvkffp
Timeline for d6d2qa1: