SCOPe 2.08: Domain d6cdsb2: 6cds B:104-214

Lineage for d6cdsb2 (6cds B:104-214)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
   core: 3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.11.2: Second domain of FERM [47031] (2 families)
   automatically mapped to Pfam PF00373

5. Family a.11.2.0: automated matches [254193] (1 protein)
   not a true family

6. Protein automated matches [254423] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255207] (60 PDB entries)

8. Domain d6cdsb2: 6cds B:104-214 [354848]
   Other proteins in same PDB: d6cdsa1, d6cdsa3, d6cdsb1, d6cdsb3
   automated match to d1isna1
   complexed with gol, peg, pio, po4

Details for d6cdsb2

PDB Entry: 6cds, 2.62 Å

PDB Description: human neurofibromin 2/merlin/schwannomin residues 1-339 in complex with pip2

PDB Compounds: (B:) merlin

SCOPe Domain Sequences for d6cdsb2:

Sequence; same for both SEQRES and ATOM records:

>d6cdsb2 a.11.2.0 (B:104-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
naeeelvqeitqhlfflqvkkqildekiycppeasvllasyavqakygdydpsvhkrgfl
aqeellpkrvinlyqmtpemweeritawyaehrgrardeaemeylkiaqdl

Timeline for d6cdsb2:

• d6cdsb2 first appeared in SCOPe 2.07