SCOPe 2.07: Domain d6bvac2: 6bva C:79-161

Lineage for d6bvac2 (6bva C:79-161)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily)
   multihelical; interlocked heterodimer with F-box proteins

4. Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families)
   automatically mapped to Pfam PF01466

5. Family a.157.1.1: Skp1 dimerisation domain-like [81380] (3 proteins)

6. Protein automated matches [226933] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225235] (12 PDB entries)

8. Domain d6bvac2: 6bva C:79-161 [354836]
   Other proteins in same PDB: d6bvaa1, d6bvaa2, d6bvab_, d6bvac1, d6bvad1, d6bvad3
   automated match to d5k35b2

Details for d6bvac2

PDB Entry: 6bva, 2.66 Å

PDB Description: ubiquitin variant (ubv.fl10.1) bound to a human skp1-fbl10 fragment complex.

PDB Compounds: (C:) S-phase kinase-associated protein 1

SCOPe Domain Sequences for d6bvac2:

Sequence; same for both SEQRES and ATOM records:

>d6bvac2 a.157.1.1 (C:79-161) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ekrtddipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirkt
fnikndfteeeeaqvrkenqwce

Timeline for d6bvac2:

• d6bvac2 is new in SCOPe 2.07-stable
  
• d6bvac2 appears in the current release, SCOPe 2.08