Lineage for d6bvac2 (6bva C:79-161)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily)
    multihelical; interlocked heterodimer with F-box proteins
  4. Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families) (S)
    automatically mapped to Pfam PF01466
  5. Family a.157.1.1: Skp1 dimerisation domain-like [81380] (3 proteins)
  6. Protein automated matches [226933] (1 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [225235] (12 PDB entries)
  8. Domain d6bvac2: 6bva C:79-161 [354836]
    Other proteins in same PDB: d6bvaa1, d6bvaa2, d6bvab_, d6bvac1, d6bvad1, d6bvad3
    automated match to d5k35b2

Details for d6bvac2

PDB Entry: 6bva (more details), 2.66 Å

PDB Description: ubiquitin variant (ubv.fl10.1) bound to a human skp1-fbl10 fragment complex.
PDB Compounds: (C:) S-phase kinase-associated protein 1

SCOPe Domain Sequences for d6bvac2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bvac2 a.157.1.1 (C:79-161) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ekrtddipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirkt
fnikndfteeeeaqvrkenqwce

SCOPe Domain Coordinates for d6bvac2 are not available.

Timeline for d6bvac2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6bvac1
View in 3D
Domains from other chains:
(mouse over for more information)
d6bvaa1, d6bvaa2, d6bvab_, d6bvad1, d6bvad2, d6bvad3