Lineage for d6bvad1 (6bva D:1-75)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2552337Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2552338Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2552678Family d.42.1.0: automated matches [191460] (1 protein)
    not a true family
  6. 2552679Protein automated matches [190710] (5 species)
    not a true protein
  7. 2552682Species Human (Homo sapiens) [TaxId:9606] [187857] (53 PDB entries)
  8. 2552807Domain d6bvad1: 6bva D:1-75 [354827]
    Other proteins in same PDB: d6bvaa1, d6bvaa2, d6bvab_, d6bvac2, d6bvad2, d6bvad3
    automated match to d5k35b1

Details for d6bvad1

PDB Entry: 6bva (more details), 2.66 Å

PDB Description: ubiquitin variant (ubv.fl10.1) bound to a human skp1-fbl10 fragment complex.
PDB Compounds: (D:) S-phase kinase-associated protein 1

SCOPe Domain Sequences for d6bvad1:

Sequence, based on SEQRES records: (download)

>d6bvad1 d.42.1.0 (D:1-75) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpsiklqssdgeifevdveiakqsvtiktmledlgmddegdddpvplpnvnaailkkviq
wcthhkddppppedd

Sequence, based on observed residues (ATOM records): (download)

>d6bvad1 d.42.1.0 (D:1-75) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpsiklqssdgeifevdveiakqsvtiktmledlddpvplpnvnaailkkviqwcthhkd
dppppedd

SCOPe Domain Coordinates for d6bvad1:

Click to download the PDB-style file with coordinates for d6bvad1.
(The format of our PDB-style files is described here.)

Timeline for d6bvad1: