Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
Superfamily d.42.1: POZ domain [54695] (3 families) |
Family d.42.1.0: automated matches [191460] (1 protein) not a true family |
Protein automated matches [190710] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187857] (53 PDB entries) |
Domain d6bvad1: 6bva D:1-75 [354827] Other proteins in same PDB: d6bvaa1, d6bvaa2, d6bvab_, d6bvac2, d6bvad2, d6bvad3 automated match to d5k35b1 |
PDB Entry: 6bva (more details), 2.66 Å
SCOPe Domain Sequences for d6bvad1:
Sequence, based on SEQRES records: (download)
>d6bvad1 d.42.1.0 (D:1-75) automated matches {Human (Homo sapiens) [TaxId: 9606]} mpsiklqssdgeifevdveiakqsvtiktmledlgmddegdddpvplpnvnaailkkviq wcthhkddppppedd
>d6bvad1 d.42.1.0 (D:1-75) automated matches {Human (Homo sapiens) [TaxId: 9606]} mpsiklqssdgeifevdveiakqsvtiktmledlddpvplpnvnaailkkviqwcthhkd dppppedd
Timeline for d6bvad1: