Lineage for d6byva1 (6byv A:1-42)

  1. Root: SCOPe 2.08
  2. Class g: Small proteins [56992] (100 folds)
  3. Fold g.12: LDL receptor-like module [57423] (1 superfamily)
    disulfide-rich calcium-binding fold
  4. Superfamily g.12.1: LDL receptor-like module [57424] (2 families) (S)
  5. Family g.12.1.0: automated matches [254261] (1 protein)
    not a true family
  6. Protein automated matches [254605] (1 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [255472] (2 PDB entries)
  8. Domain d6byva1: 6byv A:1-42 [354824]
    automated match to d1n7da7
    complexed with ca

Details for d6byva1

PDB Entry: 6byv (more details)

PDB Description: solution nmr structure of cysteine-rich calcium bound domains of very low density lipoprotein receptor
PDB Compounds: (A:) Very low-density lipoprotein receptor

SCOPe Domain Sequences for d6byva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6byva1 g.12.1.0 (A:1-42) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ktcaesdfvcnngqcvpsrwkcdgdpdcedgsdespeqchmr

SCOPe Domain Coordinates for d6byva1 are not available.

Timeline for d6byva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6byva2, d6byva3