SCOPe 2.07: Domain d6bvac1: 6bva C:1-75

Lineage for d6bvac1 (6bva C:1-75)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.0: automated matches [191460] (1 protein)
   not a true family

6. Protein automated matches [190710] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187857] (53 PDB entries)

8. Domain d6bvac1: 6bva C:1-75 [354823]
   Other proteins in same PDB: d6bvaa1, d6bvaa2, d6bvab_, d6bvac2, d6bvad2, d6bvad3
   automated match to d5k35b1

Details for d6bvac1

PDB Entry: 6bva, 2.66 Å

PDB Description: ubiquitin variant (ubv.fl10.1) bound to a human skp1-fbl10 fragment complex.

PDB Compounds: (C:) S-phase kinase-associated protein 1

SCOPe Domain Sequences for d6bvac1:

Sequence, based on SEQRES records:

>d6bvac1 d.42.1.0 (C:1-75) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpsiklqssdgeifevdveiakqsvtiktmledlgmddegdddpvplpnvnaailkkviq
wcthhkddppppedd

Sequence, based on observed residues (ATOM records):

>d6bvac1 d.42.1.0 (C:1-75) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpsiklqssdgeifevdveiakqsvtiktmledldddpvplpnvnaailkkviqwcthhk
ddppppedd

Timeline for d6bvac1:

• d6bvac1 is new in SCOPe 2.07-stable
  
• d6bvac1 appears in the current release, SCOPe 2.08