Lineage for d6bvac1 (6bva C:1-75)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. Family d.42.1.0: automated matches [191460] (1 protein)
    not a true family
  6. Protein automated matches [190710] (5 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187857] (53 PDB entries)
  8. Domain d6bvac1: 6bva C:1-75 [354823]
    Other proteins in same PDB: d6bvaa1, d6bvaa2, d6bvab_, d6bvac2, d6bvad2, d6bvad3
    automated match to d5k35b1

Details for d6bvac1

PDB Entry: 6bva (more details), 2.66 Å

PDB Description: ubiquitin variant (ubv.fl10.1) bound to a human skp1-fbl10 fragment complex.
PDB Compounds: (C:) S-phase kinase-associated protein 1

SCOPe Domain Sequences for d6bvac1:

Sequence, based on SEQRES records: (download)

>d6bvac1 d.42.1.0 (C:1-75) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpsiklqssdgeifevdveiakqsvtiktmledlgmddegdddpvplpnvnaailkkviq
wcthhkddppppedd

Sequence, based on observed residues (ATOM records): (download)

>d6bvac1 d.42.1.0 (C:1-75) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpsiklqssdgeifevdveiakqsvtiktmledldddpvplpnvnaailkkviqwcthhk
ddppppedd

SCOPe Domain Coordinates for d6bvac1 are not available.

Timeline for d6bvac1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6bvac2
View in 3D
Domains from other chains:
(mouse over for more information)
d6bvaa1, d6bvaa2, d6bvab_, d6bvad1, d6bvad2, d6bvad3